PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM02G21270.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 395aa    MW: 42485.3 Da    PI: 6.6227
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM02G21270.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.13.1e-18198252256
                      T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      rk+ +++keq   Le+ F+++++++ +++ +LA++l+L  rqV vWFqNrRa+ k
  OGLUM02G21270.1 198 RKKLRLSKEQSSFLEDSFKEHSTLTPKQKSDLANRLNLRPRQVEVWFQNRRARTK 252
                      788899***********************************************98 PP

2HD-ZIP_I/II125.91.8e-40198289192
      HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                      +kk+rlskeq+++LE+sF+e+++L+p++K++la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l++en+rL++ev+eLr +l+
  OGLUM02G21270.1 198 RKKLRLSKEQSSFLEDSFKEHSTLTPKQKSDLANRLNLRPRQVEVWFQNRRARTKLKQTEVDCEHLKRCCERLTRENRRLQREVAELRGALR 289
                      69**************************************************************************************9887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-17179252IPR009057Homeodomain-like
SuperFamilySSF466891.25E-17189255IPR009057Homeodomain-like
PROSITE profilePS5007117.135194254IPR001356Homeobox domain
SMARTSM003892.1E-16196258IPR001356Homeobox domain
PfamPF000461.5E-15198252IPR001356Homeobox domain
CDDcd000868.66E-17198255No hitNo description
PROSITE patternPS000270229252IPR017970Homeobox, conserved site
SMARTSM003405.3E-19254298IPR003106Leucine zipper, homeobox-associated
PfamPF021836.6E-11254288IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MRFKFDSESS VSRRPLSADR PRPSWRLDGG AMLTSPGFEI TAAMQICSRS DATGDSPAPV  60
KATIAPTPVL TPTCMGDEED LELVLGVRAT RRDEQDDQTT CTQSSEEAME GEEDETRPHG  120
EAPVESLSFP LFVSSAETGS ANSEMCTRGF DVNTRPADGG AEAGRPSSPS SMQEASTRQQ  180
VADQEAADDE DNGGGGARKK LRLSKEQSSF LEDSFKEHST LTPKQKSDLA NRLNLRPRQV  240
EVWFQNRRAR TKLKQTEVDC EHLKRCCERL TRENRRLQRE VAELRGALRT TTSSYPPLYG  300
LHHLPAAAGT VFRVCPSCEH SKVVAAAASE SFSPRVFACG GAPAAITAAA AVPSPGAGSP  360
PSSSAALFGA RRPHFGPFAA AVIPPVLRRQ PSATS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1246254RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0641180.0AK064118.1 Oryza sativa Japonica Group cDNA clone:002-102-B08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015626174.10.0PREDICTED: homeobox-leucine zipper protein HOX7 isoform X1
SwissprotA2X6740.0HOX7_ORYSI; Homeobox-leucine zipper protein HOX7
TrEMBLA0A0D9YTU00.0A0A0D9YTU0_9ORYZ; Uncharacterized protein
STRINGBGIOSGA006230-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP128943035
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.12e-52homeobox from Arabidopsis thaliana